Lineage for d1e6ya1 (1e6y A:1284-1569)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004845Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2004846Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2004847Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
    C-terminal domain is all-alpha
  6. 2004848Protein Alpha chain [48083] (3 species)
  7. 2004875Species Methanosarcina barkeri [TaxId:2208] [48086] (1 PDB entry)
  8. 2004876Domain d1e6ya1: 1e6y A:1284-1569 [18529]
    Other proteins in same PDB: d1e6ya2, d1e6yb1, d1e6yb2, d1e6yc_, d1e6yd2, d1e6ye1, d1e6ye2, d1e6yf_
    complexed with com, f43, gol, tp7

Details for d1e6ya1

PDB Entry: 1e6y (more details), 1.6 Å

PDB Description: methyl-coenzyme m reductase from methanosarcina barkeri
PDB Compounds: (A:) methyl-coenzyme m reductase subunit alpha

SCOPe Domain Sequences for d1e6ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ya1 a.89.1.1 (A:1284-1569) Alpha chain {Methanosarcina barkeri [TaxId: 2208]}
rrargpnepgglsfghlsdivqtsrvsedpakialevvgagcmlydqiwlgsymsggvgf
tqyataaytddildnntyydvdyindkyngaatvgkdnkvkaslevvkdiatestlygie
tyekfptaledhfggsqratvlaaaagvacslatgnanaglsgwylsmylhkeawgrlgf
fgfdlqdqcgatnvlsyqgdeglpdelrgpnypnyamnvghqggyagiaqaahsgrgdaf
tvnpllkvcfaddllpfnfaeprrefgrgairefvpagerslvipa

SCOPe Domain Coordinates for d1e6ya1:

Click to download the PDB-style file with coordinates for d1e6ya1.
(The format of our PDB-style files is described here.)

Timeline for d1e6ya1: