Lineage for d1e6ga_ (1e6g A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2053739Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 2053740Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries)
  8. 2053763Domain d1e6ga_: 1e6g A: [70083]
    complexed with so4; mutant

Details for d1e6ga_

PDB Entry: 1e6g (more details), 2.3 Å

PDB Description: a-spectrin sh3 domain a11v, v23l, m25i, v53i, v58l mutant
PDB Compounds: (A:) spectrin alpha chain

SCOPe Domain Sequences for d1e6ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ga_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
tgkelvlvlydyqekspreltikkgdiltllnstnkdwwkvevndrqgfipaaylkkld

SCOPe Domain Coordinates for d1e6ga_:

Click to download the PDB-style file with coordinates for d1e6ga_.
(The format of our PDB-style files is described here.)

Timeline for d1e6ga_: