Lineage for d1e6fa_ (1e6f A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
barrel, partly open; n*=8, S*=10; one psi loopSuperfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) 
Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins) Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species) Species Human (Homo sapiens) [TaxId:9606] [63822] (5 PDB entries) 
Domain d1e6fa_: 1e6f A: [59304]
repeat 11, IGF-II binding domain
Details for d1e6fa_
PDB Entry: 1e6f (more details), 1.75 Å
PDB Description: human mir-receptor, repeat 11
PDB Compounds: (A:) cation-independent mannose-6-phosphate receptorSCOPe Domain Sequences for d1e6fa_:
Sequence, based on SEQRES records: (download)
>d1e6fa_ b.64.1.1 (A:) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Human (Homo sapiens) [TaxId: 9606]}
ddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacfgqtris
vgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmlisldkqt
ctlffswhtplace
Sequence, based on observed residues (ATOM records): (download)
>d1e6fa_ b.64.1.1 (A:) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Human (Homo sapiens) [TaxId: 9606]}
ddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacfgqtris
vgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpnrpmlisldkqtctlff
swhtplace
SCOPe Domain Coordinates for d1e6fa_:
Click to download the PDB-style file with coordinates for d1e6fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e6fa_:
- d1e6fa_ first appeared in SCOP 1.57
- d1e6fa_ appears in SCOPe 2.04
- d1e6fa_ appears in SCOPe 2.06
- d1e6fa_ appears in the current release, SCOPe 2.08
View in 3D
