Lineage for d1e6ba1 (1e6b A:88-220)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) 
Protein Class zeta GST [81353] (2 species) Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [63556] (1 PDB entry) 
Domain d1e6ba1: 1e6b A:88-220 [59294]
Other proteins in same PDB: d1e6ba2
complexed with bme
Details for d1e6ba1
PDB Entry: 1e6b (more details), 1.65 Å
PDB Description: crystal structure of a zeta class glutathione s-transferase from arabidopsis thaliana
PDB Compounds: (A:) glutathione s-transferaseSCOPe Domain Sequences for d1e6ba1:
Sequence, based on SEQRES records: (download)
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pllprdlhkravnyqamsivlsgiqphqnlaviryieekinveektawvnnaitkgftal
ekllvncagkhatgdeiyladlflapqihgainrfqinmepyptlakcyesynelpafqn
alpekqpdapsst
Sequence, based on observed residues (ATOM records): (download)
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pllprdlhkravnyqamsivlsgiqptawvnnaitkgftalekllvncagkhatgdeiyl
adlflapqihgainrfqinmepyptlakcyesynelpafqnalpekqpdapsst
SCOPe Domain Coordinates for d1e6ba1:
Click to download the PDB-style file with coordinates for d1e6ba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e6ba1:
- d1e6ba1 first appeared in SCOP 1.57
- d1e6ba1 appears in SCOPe 2.07
View in 3D
