Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins) barrel, closed; n=5, S=8 |
Protein Inorganic pyrophosphatase [50326] (7 species) eukaryotic enzyme has additional secondary structures at both N- and C-termini |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50327] (19 PDB entries) |
Domain d1e6aa_: 1e6a A: [59292] complexed with f, mn, na, po4, pop |
PDB Entry: 1e6a (more details), 1.9 Å
SCOPe Domain Sequences for d1e6aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6aa_ b.40.5.1 (A:) Inorganic pyrophosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi dltnvtlpdtptyskaasdaippaslkadapidksidkwffisg
Timeline for d1e6aa_: