Lineage for d1e4ea1 (1e4e A:2-131)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
possible rudiment form of Rossmann-fold domainSuperfamily c.30.1: PreATP-grasp domain [52440] (10 families) 
precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins) 
Protein D-alanine:D-lactate ligase VanA, N-domain [52455] (2 species) 
Species Enterococcus faecium [TaxId:1352] [63983] (1 PDB entry) 
Domain d1e4ea1: 1e4e A:2-131 [59221]
Other proteins in same PDB: d1e4ea2, d1e4eb2
complexed with adp, gol, mg, phy, so4
Details for d1e4ea1
PDB Entry: 1e4e (more details), 2.5 Å
PDB Description: d-alanyl-d-lacate ligase
PDB Compounds: (A:) vancomycin/teicoplanin a-type resistance protein vanaSCOPe Domain Sequences for d1e4ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4ea1 c.30.1.2 (A:2-131) D-alanine:D-lactate ligase VanA, N-domain {Enterococcus faecium [TaxId: 1352]}
nrikvailfggcseehdvsvksaieiaaninkekyeplyigitksgvwkmcekpcaewen
encysavlspdkkmhgllvkknheyeinhvdvafsalhgksgedgsiqglfelsgipfvg
cdiqssaicm
SCOPe Domain Coordinates for d1e4ea1:
Click to download the PDB-style file with coordinates for d1e4ea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e4ea1:
- d1e4ea1 first appeared in SCOP 1.57
- d1e4ea1 appears in SCOPe 2.07
View in 3D
