Lineage for d1e3rb_ (1e3r B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheetSuperfamily d.17.4: NTF2-like [54427] (31 families) 
has a beta-alpha(2)-beta insertion after the main helixFamily d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
automatically mapped to Pfam PF12680
automatically mapped to Pfam PF02136Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species) Species Pseudomonas putida [TaxId:303] [54437] (61 PDB entries)
Uniprot P07445
Domain d1e3rb_: 1e3r B: [59200]
complexed with and; mutant
Details for d1e3rb_
PDB Entry: 1e3r (more details), 2.5 Å
PDB Description: crystal structure of ketosteroid isomerase mutant d40n (d38n ti numbering) from pseudomonas putida complexed with androsten-3beta-ol-17-one
PDB Compounds: (B:) isomeraseSCOPe Domain Sequences for d1e3rb_:
Sequence, based on SEQRES records: (download)
>d1e3rb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
mnlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqg
lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
sevnlsv
Sequence, based on observed residues (ATOM records): (download)
>d1e3rb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
mnlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqg
lgkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywse
vnlsv
SCOPe Domain Coordinates for d1e3rb_:
Click to download the PDB-style file with coordinates for d1e3rb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e3rb_:
- d1e3rb_ first appeared in SCOP 1.57
- d1e3rb_ appears in SCOPe 2.07
View in 3D
