Lineage for d1e0ya1 (1e0y A:274-560)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) 
duplication: contains two subdomains of this fold
Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins)
automatically mapped to Pfam PF02913
Protein Vanillyl-alcohol oxidase [55105] (1 species) Species Fungus (Penicillium simplicissimum) [TaxId:69488] [55106] (16 PDB entries)
Uniprot P56216
Domain d1e0ya1: 1e0y A:274-560 [39467]
Other proteins in same PDB: d1e0ya2, d1e0yb2
complexed with fad, fcr; mutant
Details for d1e0ya1
PDB Entry: 1e0y (more details), 2.75 Å
PDB Description: structure of the d170s/t457e double mutant of vanillyl-alcohol oxidase
PDB Compounds: (A:) vanillyl-alcohol oxidaseSCOPe Domain Sequences for d1e0ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0ya1 d.58.32.1 (A:274-560) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
ggyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhilldaavlgdkrsyssrtep
lsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdafsaipgvkfyfpedtpens
vlrvrdktmqgiptydelkwidwlpngahlffspiakvsgedammqyavtkkrcqeagld
figeftvgmremhhivcivfnkkdliqkrkvqwlmrtliddcaangwgeyrthlafmdqi
metynwnnssflrfnevlknavdpngiiapgksgvwpsqyshvtwkl
SCOPe Domain Coordinates for d1e0ya1:
Click to download the PDB-style file with coordinates for d1e0ya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e0ya1:
- d1e0ya1 first appeared (with stable ids) in SCOP 1.55
- d1e0ya1 appears in SCOPe 2.05
- d1e0ya1 appears in SCOPe 2.07
- d1e0ya1 appears in the current release, SCOPe 2.08
View in 3D
