![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
![]() | Superfamily d.24.1: Pili subunits [54523] (7 families) ![]() bacterial filament proteins |
![]() | Family d.24.1.1: Pilin [54524] (4 proteins) |
![]() | Protein Type IV Pilin Pak [109620] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [54527] (8 PDB entries) |
![]() | Domain d1dzoa_: 1dzo A: [38378] mutant |
PDB Entry: 1dzo (more details), 1.63 Å
SCOP Domain Sequences for d1dzoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dzoa_ d.24.1.1 (A:) Type IV Pilin Pak {Pseudomonas aeruginosa [TaxId: 287]} gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr
Timeline for d1dzoa_: