Lineage for d1dzfa2 (1dzf A:144-215)
- Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/betaSuperfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family) 
Family d.78.1.1: RPB5 [55288] (2 proteins) Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries)
Uniprot P20434; part of multichain biological unit
Domain d1dzfa2: 1dzf A:144-215 [39753]
Other proteins in same PDB: d1dzfa1
Details for d1dzfa2
PDB Entry: 1dzf (more details), 1.9 Å
PDB Description: RPB5 from S.cerevisiae
PDB Compounds: (A:) DNA-directed RNA polymerases I, II, and III 27 kd polypeptideSCOPe Domain Sequences for d1dzfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dzfa2 d.78.1.1 (A:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm
SCOPe Domain Coordinates for d1dzfa2:
Click to download the PDB-style file with coordinates for d1dzfa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dzfa2:
- d1dzfa2 first appeared (with stable ids) in SCOP 1.55
- d1dzfa2 appears in SCOPe 2.01
- d1dzfa2 appears in SCOPe 2.03
- d1dzfa2 appears in the current release, SCOPe 2.08
View in 3D
