Lineage for d1dzfa1 (1dzf A:5-143)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) 
Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins) Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (27 PDB entries)
Uniprot P20434; part of multichain biological unit
Domain d1dzfa1: 1dzf A:5-143 [33344]
Other proteins in same PDB: d1dzfa2
Details for d1dzfa1
PDB Entry: 1dzf (more details), 1.9 Å
PDB Description: RPB5 from S.cerevisiae
PDB Compounds: (A:) DNA-directed RNA polymerases I, II, and III subunit rpabc 1SCOPe Domain Sequences for d1dzfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dzfa1 c.52.3.1 (A:5-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqanp
teesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamklv
psippatietfneaalvvn
SCOPe Domain Coordinates for d1dzfa1:
Click to download the PDB-style file with coordinates for d1dzfa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dzfa1:
- d1dzfa1 first appeared (with stable ids) in SCOP 1.55
- d1dzfa1 appears in SCOPe 2.07
View in 3D
