Lineage for d1dzaa_ (1dza A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.5: RNase A-like [54075] (1 superfamily)
contains long curved beta-sheet and 3 helicesSuperfamily d.5.1: RNase A-like [54076] (2 families) 
can be classified as disulfide-richFamily d.5.1.1: Ribonuclease A-like [54077] (9 proteins) Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species) 
Species Human (Homo sapiens), des1-7 [TaxId:9606] [54080] (8 PDB entries) 
Domain d1dzaa_: 1dza A: [37275]
designed cytotoxic mutant
Details for d1dzaa_
PDB Entry: 1dza (more details), 1.65 Å
PDB Description: 3-d structure of a hp-rnase
PDB Compounds: (A:) ribonuclease 1SCOPe Domain Sequences for d1dzaa_:
Sequence, based on SEQRES records: (download)
>d1dzaa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7 [TaxId: 9606]}
mkesaaakferqhmdsgnspsssstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcf
qekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvh
fdasve
Sequence, based on observed residues (ATOM records): (download)
>d1dzaa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Human (Homo sapiens), des1-7 [TaxId: 9606]}
mkesaaakferqhmdsgnstycnqmmrrrnmtqgrckpvntfvheslvdvqnvcfqekvt
ckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhfdasv
e
SCOPe Domain Coordinates for d1dzaa_:
Click to download the PDB-style file with coordinates for d1dzaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dzaa_:
- d1dzaa_ first appeared (with stable ids) in SCOP 1.55
- d1dzaa_ appears in SCOPe 2.04
- d1dzaa_ appears in SCOPe 2.06
- d1dzaa_ appears in the current release, SCOPe 2.08
View in 3D
