Lineage for d1dxga_ (1dxg A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036508Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 3036654Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
    automatically mapped to Pfam PF06397
  6. 3036665Protein Desulforedoxin [57814] (1 species)
    dimeric mono-domain protein with two rubredoxin-type metal centres
  7. 3036666Species Desulfovibrio gigas [TaxId:879] [57815] (6 PDB entries)
  8. 3036667Domain d1dxga_: 1dxg A: [45247]
    complexed with fe

Details for d1dxga_

PDB Entry: 1dxg (more details), 1.8 Å

PDB Description: crystal structure of desulforedoxin from desulfovibrio gigas at 1.8 a resolution
PDB Compounds: (A:) desulforedoxin

SCOPe Domain Sequences for d1dxga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxga_ g.41.5.2 (A:) Desulforedoxin {Desulfovibrio gigas [TaxId: 879]}
anegdvykcelcgqvvkvleegggtlvccgedmvkq

SCOPe Domain Coordinates for d1dxga_:

Click to download the PDB-style file with coordinates for d1dxga_.
(The format of our PDB-style files is described here.)

Timeline for d1dxga_:

3036667
d1dxga_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1dxgb_