Lineage for d1dwoa_ (1dwo A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
automatically mapped to Pfam PF12697Protein Hydroxynitrile lyase [53586] (2 species) 
Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (9 PDB entries) 
Domain d1dwoa_: 1dwo A: [34804]
complexed with acn
Details for d1dwoa_
PDB Entry: 1dwo (more details), 2.2 Å
PDB Description: crystal structure of hydroxynitrile lyase from manihot esculenta in complex with substrates acetone and chloroacetone:implications for the mechanism of cyanogenesis
PDB Compounds: (A:) hydroxynitrile lyaseSCOPe Domain Sequences for d1dwoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dwoa_ c.69.1.20 (A:) Hydroxynitrile lyase {Cassava (Manihot esculenta) [TaxId: 3983]}
piskmvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfde
yseplltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsy
tvekllesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrk
gslfqnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdh
klqltkteevahilqevadaya
SCOPe Domain Coordinates for d1dwoa_:
Click to download the PDB-style file with coordinates for d1dwoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dwoa_:
- d1dwoa_ first appeared (with stable ids) in SCOP 1.55
- d1dwoa_ appears in SCOPe 2.04
- d1dwoa_ is called d1dwoa1 in SCOPe 2.06
- d1dwoa_ appears in the current release, SCOPe 2.08, called d1dwoa1
View in 3D
