Lineage for d1dw6c_ (1dw6 C:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671907Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 671908Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 671909Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 671925Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 671926Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (230 PDB entries)
  8. 672094Domain d1dw6c_: 1dw6 C: [26545]

Details for d1dw6c_

PDB Entry: 1dw6 (more details), 1.88 Å

PDB Description: structural and kinetic analysis of drug resistant mutants of hiv-1 protease
PDB Compounds: (C:) hiv-1 protease

SCOP Domain Sequences for d1dw6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dw6c_ b.50.1.1 (C:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlmtqigatlnf

SCOP Domain Coordinates for d1dw6c_:

Click to download the PDB-style file with coordinates for d1dw6c_.
(The format of our PDB-style files is described here.)

Timeline for d1dw6c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dw6d_