Lineage for d1duvg2 (1duv G:151-333)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) 
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) Protein Ornithine transcarbamoylase [53676] (6 species) Species Escherichia coli [TaxId:562] [53678] (3 PDB entries) 
Domain d1duvg2: 1duv G:151-333 [35229]
complexed with mpd, psq
Details for d1duvg2
PDB Entry: 1duv (more details), 1.7 Å
PDB Description: crystal structure of e. coli ornithine transcarbamoylase complexed with ndelta-l-ornithine-diaminophosphinyl-n-sulphonic acid (psorn)
PDB Compounds: (G:) ornithine transcarbamoylaseSCOPe Domain Sequences for d1duvg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]}
kafnemtlvyagdarnnmgnsmleaaaltgldlrlvapqacwpeaalvtecralaqqngg
nitltedvakgvegadfiytdvwvsmgeakekwaeriallreyqvnskmmqltgnpevkf
lhclpafhddqttlgkkmaeefglhggmevtdevfesaasivfdqaenrmhtikavmvat
lsk
SCOPe Domain Coordinates for d1duvg2:
Click to download the PDB-style file with coordinates for d1duvg2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1duvg2:
- d1duvg2 first appeared (with stable ids) in SCOP 1.55
- d1duvg2 appears in SCOPe 2.04
- d1duvg2 appears in SCOPe 2.06
- d1duvg2 appears in the current release, SCOPe 2.08
 View in 3DDomains from other chains: (mouse over for more information) d1duvh1, d1duvh2, d1duvi1, d1duvi2 |
