Lineage for d1duvg2 (1duv G:151-333)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906434Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2906745Protein Ornithine transcarbamoylase [53676] (6 species)
  7. 2906746Species Escherichia coli [TaxId:562] [53678] (3 PDB entries)
  8. 2906748Domain d1duvg2: 1duv G:151-333 [35229]
    complexed with mpd, psq

Details for d1duvg2

PDB Entry: 1duv (more details), 1.7 Å

PDB Description: crystal structure of e. coli ornithine transcarbamoylase complexed with ndelta-l-ornithine-diaminophosphinyl-n-sulphonic acid (psorn)
PDB Compounds: (G:) ornithine transcarbamoylase

SCOPe Domain Sequences for d1duvg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]}
kafnemtlvyagdarnnmgnsmleaaaltgldlrlvapqacwpeaalvtecralaqqngg
nitltedvakgvegadfiytdvwvsmgeakekwaeriallreyqvnskmmqltgnpevkf
lhclpafhddqttlgkkmaeefglhggmevtdevfesaasivfdqaenrmhtikavmvat
lsk

SCOPe Domain Coordinates for d1duvg2:

Click to download the PDB-style file with coordinates for d1duvg2.
(The format of our PDB-style files is described here.)

Timeline for d1duvg2:

2906748
d1duvg2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1duvg1