| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
| Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
| Protein Ornithine transcarbamoylase [53676] (6 species) |
| Species Escherichia coli [TaxId:562] [53678] (3 PDB entries) |
| Domain d1duvg2: 1duv G:151-333 [35229] complexed with mpd, psq |
PDB Entry: 1duv (more details), 1.7 Å
SCOPe Domain Sequences for d1duvg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]}
kafnemtlvyagdarnnmgnsmleaaaltgldlrlvapqacwpeaalvtecralaqqngg
nitltedvakgvegadfiytdvwvsmgeakekwaeriallreyqvnskmmqltgnpevkf
lhclpafhddqttlgkkmaeefglhggmevtdevfesaasivfdqaenrmhtikavmvat
lsk
Timeline for d1duvg2:
View in 3DDomains from other chains: (mouse over for more information) d1duvh1, d1duvh2, d1duvi1, d1duvi2 |