Lineage for d1dtwb2 (1dtw B:205-342)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the restSuperfamily c.48.1: TK C-terminal domain-like [52922] (3 families) 
Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins) Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species) Species Human (Homo sapiens) [TaxId:9606] [52928] (21 PDB entries)
Uniprot P21953 52-392
Domain d1dtwb2: 1dtw B:205-342 [33102]
Other proteins in same PDB: d1dtwa_, d1dtwb1
complexed with k, mg, tdp
Details for d1dtwb2
PDB Entry: 1dtw (more details), 2.7 Å
PDB Description: human branched-chain alpha-keto acid dehydrogenase
PDB Compounds: (B:) branched-chain alpha-keto acid dehydrogenase beta subunitSCOP Domain Sequences for d1dtwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dtwb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy
SCOP Domain Coordinates for d1dtwb2:
Click to download the PDB-style file with coordinates for d1dtwb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dtwb2:
- d1dtwb2 first appeared (with stable ids) in SCOP 1.55
- d1dtwb2 appears in SCOP 1.73
- d1dtwb2 appears in SCOPe 2.01
- d1dtwb2 appears in the current release, SCOPe 2.08
View in 3D
