Lineage for d1dtwb2 (1dtw B:205-342)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 834846Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 834847Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 834899Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)
  6. 834907Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)
  7. 834908Species Human (Homo sapiens) [TaxId:9606] [52928] (21 PDB entries)
    Uniprot P21953 52-392
  8. 834929Domain d1dtwb2: 1dtw B:205-342 [33102]
    Other proteins in same PDB: d1dtwa_, d1dtwb1
    complexed with k, mg, tdp

Details for d1dtwb2

PDB Entry: 1dtw (more details), 2.7 Å

PDB Description: human branched-chain alpha-keto acid dehydrogenase
PDB Compounds: (B:) branched-chain alpha-keto acid dehydrogenase beta subunit

SCOP Domain Sequences for d1dtwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtwb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy

SCOP Domain Coordinates for d1dtwb2:

Click to download the PDB-style file with coordinates for d1dtwb2.
(The format of our PDB-style files is described here.)

Timeline for d1dtwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dtwb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1dtwa_