Lineage for d1dtjd_ (1dtj D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947087Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2947124Protein Neuro-oncological ventral antigen 2, nova-2, KH3 [54795] (1 species)
  7. 2947125Species Human (Homo sapiens) [TaxId:9606] [54796] (2 PDB entries)
  8. 2947129Domain d1dtjd_: 1dtj D: [38803]

Details for d1dtjd_

PDB Entry: 1dtj (more details), 2 Å

PDB Description: crystal structure of nova-2 kh3 k-homology rna-binding domain
PDB Compounds: (D:) RNA-binding neurooncological ventral antigen 2

SCOPe Domain Sequences for d1dtjd_:

Sequence, based on SEQRES records: (download)

>d1dtjd_ d.51.1.1 (D:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]}
mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
atqaaqylisqrv

Sequence, based on observed residues (ATOM records): (download)

>d1dtjd_ d.51.1.1 (D:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]}
mkelvemavpenlvgailgkggktlveyqeltgariqisrnrrvtitgspaatqaaqyli
sqrv

SCOPe Domain Coordinates for d1dtjd_:

Click to download the PDB-style file with coordinates for d1dtjd_.
(The format of our PDB-style files is described here.)

Timeline for d1dtjd_: