Lineage for d1ds7a_ (1ds7 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528714Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2528715Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2528716Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2528765Protein Oxygen-insensitive NAD(P)H nitroreductase [55476] (3 species)
  7. 2528794Species Escherichia coli, minor form, NfnB [TaxId:562] [55478] (9 PDB entries)
  8. 2528813Domain d1ds7a_: 1ds7 A: [40253]
    complexed with fmn

Details for d1ds7a_

PDB Entry: 1ds7 (more details), 2.06 Å

PDB Description: a minor fmn-dependent nitroreductase from escherichia coli b
PDB Compounds: (A:) fmn-dependent nitroreductase

SCOPe Domain Sequences for d1ds7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ds7a_ d.90.1.1 (A:) Oxygen-insensitive NAD(P)H nitroreductase {Escherichia coli, minor form, NfnB [TaxId: 562]}
mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
aksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
rkffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
kgytslvvvpvghhsvedfnatlpksrlpqnitltev

SCOPe Domain Coordinates for d1ds7a_:

Click to download the PDB-style file with coordinates for d1ds7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ds7a_: