Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51380] (2 PDB entries) |
Domain d1dqwa_: 1dqw A: [28551] |
PDB Entry: 1dqw (more details), 2.1 Å
SCOPe Domain Sequences for d1dqwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqwa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mhkatykeraathpspvaaklfnimhekqtnlcasldvrttkellelvealgpkicllkt hvdiltdfsmegtvkplkalsakynfllfedrkfadigntvklqysagvyriaewaditn ahgvvgpgivsglkqaaeevtkeprgllmlaelsckgslstgeytkgtvdiaksdkdfvi gfiaqrdmggrdegydwlimtpgvglddkgdalgqqyrtvddvvstgsdiiivgrglfak grdakvegeryrkagweaylrrcgqqd
Timeline for d1dqwa_: