| Class g: Small proteins [56992] (90 folds) |
| Fold g.31: Invertebrate chitin-binding proteins [57624] (1 superfamily) disulfide-rich |
Superfamily g.31.1: Invertebrate chitin-binding proteins [57625] (2 families) ![]() shares a putative chitin-binding motif with the plant lectins/antimicrobial peptides superfamily but lacks one of the conserved disulfides of the knottin fold |
| Family g.31.1.1: Tachycitin [57626] (1 protein) |
| Protein Tachycitin [57627] (1 species) an antimicrobial protein with chitin-binding function |
| Species Horseshoe crab (Tachypleus tridentatus) [TaxId:6853] [57628] (1 PDB entry) |
| Domain d1dqca_: 1dqc A: [44964] complexed with nh2 |
PDB Entry: 1dqc (more details)
SCOP Domain Sequences for d1dqca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqca_ g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]}
ylafrcgryspclddgpnvnlysccsfynchkclarlencpkglhynaylkvcdwpskag
ctsvnkechlwkt
Timeline for d1dqca_: