Lineage for d1dpua_ (1dpu A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1478903Family a.4.5.16: C-terminal domain of RPA32 [46844] (2 proteins)
  6. 1478904Protein C-terminal domain of RPA32 [46845] (1 species)
    peptide-recognition motif
  7. 1478905Species Human (Homo sapiens) [TaxId:9606] [46846] (2 PDB entries)
  8. 1478906Domain d1dpua_: 1dpu A: [16150]
    complexed with the fragment 73-88 of uracil DNA glycosylase UNG2
    protein/DNA complex

Details for d1dpua_

PDB Entry: 1dpu (more details)

PDB Description: solution structure of the c-terminal domain of human rpa32 complexed with ung2(73-88)
PDB Compounds: (A:) replication protein a (rpa32) c-terminal domain

SCOPe Domain Sequences for d1dpua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]}
angltvaqnqvlnlikacprpeglnfqdlknqlkhmsvssikqavdflsneghiystvdd
dhfkstdae

SCOPe Domain Coordinates for d1dpua_:

Click to download the PDB-style file with coordinates for d1dpua_.
(The format of our PDB-style files is described here.)

Timeline for d1dpua_: