Class a: All alpha proteins [46456] (258 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) contains a small beta-sheet (wing) |
Family a.4.5.16: C-terminal domain of RPA32 [46844] (1 protein) |
Protein C-terminal domain of RPA32 [46845] (1 species) peptide-recognition motif |
Species Human (Homo sapiens) [TaxId:9606] [46846] (2 PDB entries) |
Domain d1dpua_: 1dpu A: [16150] complexed with the fragment 73-88 of uracil DNA glycosylase UNG2 |
PDB Entry: 1dpu (more details)
SCOP Domain Sequences for d1dpua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} angltvaqnqvlnlikacprpeglnfqdlknqlkhmsvssikqavdflsneghiystvdd dhfkstdae
Timeline for d1dpua_: