Lineage for d1dpca_ (1dpc A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874558Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2874559Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2874560Family c.43.1.1: CAT-like [52778] (3 proteins)
    trimeric enzymes with the active sites being located in between subunits
  6. 2874616Protein Dihydrolipoamide acetyltransferase [52782] (2 species)
  7. 2874617Species Azotobacter vinelandii [TaxId:354] [52783] (9 PDB entries)
  8. 2874619Domain d1dpca_: 1dpc A: [32619]

Details for d1dpca_

PDB Entry: 1dpc (more details), 2.6 Å

PDB Description: crystallographic and enzymatic investigations on the role of ser558, his610 and asn614 in the catalytic mechanism of azotobacter vinelandii dihydrolipoamide acetyltransferase (e2p)
PDB Compounds: (A:) dihydrolipoyl-transacetylase

SCOPe Domain Sequences for d1dpca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpca_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]}
ippippvdfakygeieevpmtrlmqigatnlhrswlnvphvtqfesaditeleafrvaqk
avaekagvkltvlplllkacayllkelpdfnsslapsgqalirkkyvhigfavdtpdgll
vpvirnvdqksllqlaaeaaelaekarskklgadamqgacftisslghiggtaftpivna
pevailgvskasmqpvwdgkafqprlmlplslsydhrvidgaaaarftkrlgdlladira
ill

SCOPe Domain Coordinates for d1dpca_:

Click to download the PDB-style file with coordinates for d1dpca_.
(The format of our PDB-style files is described here.)

Timeline for d1dpca_: