Lineage for d1doza_ (1doz A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008088Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1008089Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 1008090Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
  6. 1008091Protein Ferrochelatase [53802] (3 species)
  7. 1008092Species Bacillus subtilis [TaxId:1423] [53803] (15 PDB entries)
  8. 1008095Domain d1doza_: 1doz A: [35592]
    complexed with mg

Details for d1doza_

PDB Entry: 1doz (more details), 1.8 Å

PDB Description: crystal structure of ferrochelatase
PDB Compounds: (A:) Ferrochelatase

SCOPe Domain Sequences for d1doza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1doza_ c.92.1.1 (A:) Ferrochelatase {Bacillus subtilis [TaxId: 1423]}
srkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqite
qqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfs
vqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivs
ahslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrd
lfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidala
tvvlkklgr

SCOPe Domain Coordinates for d1doza_:

Click to download the PDB-style file with coordinates for d1doza_.
(The format of our PDB-style files is described here.)

Timeline for d1doza_: