Lineage for d1doab_ (1doa B:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (24 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.8: RhoGDI-like [81288] (3 proteins) Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species) - Species Cow (Bos taurus) [TaxId:9913] [49243] (3 PDB entries)
Domain d1doab_: 1doa B: [21904]
Other proteins in same PDB: d1doaa_
complexed with gdp, ger, mg
Details for d1doab_
PDB Entry: 1doa (more details), 2.6 Å
PDB Description: Structure of the rho family gtp-binding protein cdc42 in complex with the multifunctional regulator rhogdi
PDB Compounds: (B:) protein (GDP-dissociation inhibitor 1)SCOPe Domain Sequences for d1doab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1doab_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus) [TaxId: 9913]}
eptaeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrvavsad
pnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniksrftdd
drtdhlswewnltikkewkd
SCOPe Domain Coordinates for d1doab_:
Click to download the PDB-style file with coordinates for d1doab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1doab_:
- d1doab_ first appeared (with stable ids) in SCOP 1.55
- d1doab_ appears in SCOPe 2.04
- d1doab_ appears in SCOPe 2.06
- d1doab_ appears in the current release, SCOPe 2.08
View in 3D
