Lineage for d1doaa_ (1doa A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein CDC42 [52619] (2 species) Species Human (Homo sapiens) [TaxId:9606] [52620] (28 PDB entries) 
Domain d1doaa_: 1doa A: [32065]
Other proteins in same PDB: d1doab_
complexed with gdp, ger, mg
Details for d1doaa_
PDB Entry: 1doa (more details), 2.6 Å
PDB Description: Structure of the rho family gtp-binding protein cdc42 in complex with the multifunctional regulator rhogdi
PDB Compounds: (A:) protein (GTP-binding protein)SCOPe Domain Sequences for d1doaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1doaa_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
gshmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfd
tagqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqi
dlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
eppepkksrrc
SCOPe Domain Coordinates for d1doaa_:
Click to download the PDB-style file with coordinates for d1doaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1doaa_:
- d1doaa_ first appeared (with stable ids) in SCOP 1.55
- d1doaa_ appears in SCOPe 2.04
- d1doaa_ appears in SCOPe 2.06
- d1doaa_ appears in the current release, SCOPe 2.08, called d1doaa1
View in 3D
