Lineage for d1do0a_ (1do0 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. Protein HslU [52721] (2 species)
    ATPase subunit of ATP-dependent protease
  7. Species Escherichia coli [TaxId:562] [52722] (11 PDB entries)
  8. Domain d1do0a_: 1do0 A: [32432]
    complexed with atp, mg, so4
    has additional subdomain(s) that are not in the common domain

Details for d1do0a_

PDB Entry: 1do0 (more details), 3 Å

PDB Description: orthorhombic crystal form of heat shock locus u (hslu) from escherichia coli
PDB Compounds: (A:) protein (heat shock locus u)

SCOPe Domain Sequences for d1do0a_:

Sequence, based on SEQRES records: (download)

>d1do0a_ c.37.1.20 (A:) HslU {Escherichia coli [TaxId: 562]}
semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaap
mgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelkq
daidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktdh
ilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalmat
egvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqnitid
adyvskhldalvadedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1do0a_ c.37.1.20 (A:) HslU {Escherichia coli [TaxId: 562]}
semtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptgv
gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknry
raeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidarklk
ikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsregv
qrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqaltt
sdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrlht
vlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil

SCOPe Domain Coordinates for d1do0a_ are not available.

Timeline for d1do0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1do0b_, d1do0c_, d1do0d_, d1do0e_, d1do0f_