Lineage for d1dmha_ (1dmh A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.3: Prealbumin-like [49451] (8 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) 
Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
sandwich; 9 strands in 2 sheets
Protein Catechol 1,2-dioxygenase [49484] (1 species)
contains alpha-helical dimerization subdomain at the N-terminusSpecies Acinetobacter calcoaceticus [TaxId:471] [49485] (4 PDB entries) 
Domain d1dmha_: 1dmh A: [22633]
complexed with fe, lio, mct
Details for d1dmha_
PDB Entry: 1dmh (more details), 1.7 Å
PDB Description: structure of catechol 1,2-dioxygenase from acinetobacter sp. adp1 with bound 4-methylcatechol
PDB Compounds: (A:) catechol 1,2-dioxygenaseSCOPe Domain Sequences for d1dmha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dmha_ b.3.6.1 (A:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus [TaxId: 471]}
vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
vvdrprlav
SCOPe Domain Coordinates for d1dmha_:
Click to download the PDB-style file with coordinates for d1dmha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dmha_:
View in 3D
