Lineage for d1dm9b_ (1dm9 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956861Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 2956862Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 2956941Family d.66.1.3: Heat shock protein 15 kD [55182] (2 proteins)
    there are additional C-terminal structures
  6. 2956942Protein Heat shock protein 15 kD [55183] (1 species)
    ribosome-binding protein
  7. 2956943Species Escherichia coli [TaxId:562] [55184] (2 PDB entries)
  8. 2956945Domain d1dm9b_: 1dm9 B: [39561]
    complexed with so4

Details for d1dm9b_

PDB Entry: 1dm9 (more details), 2 Å

PDB Description: heat shock protein 15 kd
PDB Compounds: (B:) hypothetical 15.5 kd protein in mrca-pcka intergenic region

SCOPe Domain Sequences for d1dm9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dm9b_ d.66.1.3 (B:) Heat shock protein 15 kD {Escherichia coli [TaxId: 562]}
kpavevrldkwlwaarfyktralaremieggkvhyngqrskpskivelnatltlrqgnde
rtvivkaiteqrrpaseaallyeetaesvekrekmalarklnaltmp

SCOPe Domain Coordinates for d1dm9b_:

Click to download the PDB-style file with coordinates for d1dm9b_.
(The format of our PDB-style files is described here.)

Timeline for d1dm9b_:

2956945
d1dm9b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1dm9a_