Lineage for d1dlca3 (1dlc A:61-289)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021084Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) (S)
    automatically mapped to Pfam PF03945
  5. 3021085Family f.1.3.1: delta-Endotoxin (insectocide), N-terminal domain [56850] (2 proteins)
    seven-helical bundle with central helix surrounded by six others
  6. 3021086Protein delta-Endotoxin (insectocide), N-terminal domain [56851] (5 species)
  7. 3021089Species Bacillus thuringiensis tenebrionis, CRYIIIA (BT13) [TaxId:1444] [56852] (1 PDB entry)
  8. 3021090Domain d1dlca3: 1dlc A:61-289 [43391]
    Other proteins in same PDB: d1dlca1, d1dlca2

Details for d1dlca3

PDB Entry: 1dlc (more details), 2.5 Å

PDB Description: crystal structure of insecticidal delta-endotoxin from bacillus thuringiensis at 2.5 angstroms resolution
PDB Compounds: (A:) delta-endotoxin cryiiia

SCOPe Domain Sequences for d1dlca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlca3 f.1.3.1 (A:61-289) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis tenebrionis, CRYIIIA (BT13) [TaxId: 1444]}
ttkdviqkgisvvgdllgvvgfpfggalvsfytnflntiwpsedpwkafmeqvealmdqk
iadyaknkalaelqglqnnvedyvsalsswqknpvssrnphsqgrirelfsqaeshfrns
mpsfaisgyevlflttyaqaanthlfllkdaqiygeewgyekediaefykrqlkltqeyt
dhcvkwynvgldklrgssyeswvnfnryrremtltvldlialfplydvr

SCOPe Domain Coordinates for d1dlca3:

Click to download the PDB-style file with coordinates for d1dlca3.
(The format of our PDB-style files is described here.)

Timeline for d1dlca3: