Lineage for d1dkxa2 (1dkx A:389-506)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824537Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 2824538Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 2824539Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)
  6. 2824543Protein DnaK [100922] (3 species)
  7. 2824547Species Escherichia coli [TaxId:562] [100923] (7 PDB entries)
  8. 2824549Domain d1dkxa2: 1dkx A:389-506 [90340]
    Other proteins in same PDB: d1dkxa1
    complexed with peptide, chain B
    protein/DNA complex

Details for d1dkxa2

PDB Entry: 1dkx (more details), 2 Å

PDB Description: the substrate binding domain of dnak in complex with a substrate peptide, determined from type 1 selenomethionyl crystals
PDB Compounds: (A:) substrate binding domain of dnak

SCOPe Domain Sequences for d1dkxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkxa2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]}
vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqgerkra
adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassg

SCOPe Domain Coordinates for d1dkxa2:

Click to download the PDB-style file with coordinates for d1dkxa2.
(The format of our PDB-style files is described here.)

Timeline for d1dkxa2: