Lineage for d1dkua1 (1dku A:8-166)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891815Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins)
    duplication: consists of two domains of this fold
  6. 2891816Protein Phosphoribosylpyrophosphate synthetase [53297] (2 species)
  7. 2891817Species Bacillus subtilis [TaxId:1423] [53298] (3 PDB entries)
  8. 2891818Domain d1dkua1: 1dku A:8-166 [34118]
    complexed with abm, ap2

Details for d1dkua1

PDB Entry: 1dku (more details), 2.2 Å

PDB Description: crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation.
PDB Compounds: (A:) protein (phosphoribosyl pyrophosphate synthetase)

SCOPe Domain Sequences for d1dkua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkua1 c.61.1.2 (A:8-166) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]}
nlkifslnsnpelakeiadivgvqlgkcsvtrfsdgevqinieesirgcdcyiiqstsdp
vnehimellimvdalkrasaktinivipyygyarqdrkarsrepitaklfanlletagat
rvialdlhapqiqgffdipidhlmgvpilgeyfegknle

SCOPe Domain Coordinates for d1dkua1:

Click to download the PDB-style file with coordinates for d1dkua1.
(The format of our PDB-style files is described here.)

Timeline for d1dkua1:

2891818
d1dkua1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1dkua2