Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) |
Family c.60.1.2: Histidine acid phosphatase [53258] (4 proteins) |
Protein Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) [53263] (4 species) |
Species Escherichia coli [TaxId:562] [53266] (6 PDB entries) |
Domain d1dkqa_: 1dkq A: [33998] complexed with hg, ihp |
PDB Entry: 1dkq (more details), 2.05 Å
SCOPe Domain Sequences for d1dkqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dkqa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]} qsepelklesvvivsragvraptkatqlmqdvtpdawptwpvklgwltprggeliaylgh yqrqrlvadgllakkgcpqsgqvaiiadvdertrktgeafaaglapdcaitvhtqtdtss pdplfnplktgvcqldnanvtdailsraggsiadftghrqtafrelervlnfpqsnlclk rekqdescsltqalpselkvsadnvsltgavslasmlteifllqqaqgmpepgwgritds hqwntllslhnaqfyllqrtpevarsratplldliktaltphppqkqaygvtlptsvlfi aghdtnlanlggalelnwtlpgqpdntppggelvferwrrlsdnsqwiqvslvfqtlqqm rdktplslntppgevkltlagceernaqgmcslagftqivnearipacsl
Timeline for d1dkqa_: