Lineage for d1dkha_ (1dkh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943155Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 2943156Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) (S)
  5. 2943157Family d.35.1.1: Heme-binding protein A (HasA) [54622] (2 proteins)
    automatically mapped to Pfam PF06438
  6. 2943158Protein Heme-binding protein A (HasA) [54623] (1 species)
  7. 2943159Species Serratia marcescens [TaxId:615] [54624] (6 PDB entries)
  8. 2943167Domain d1dkha_: 1dkh A: [38533]
    complexed with hem, sm, zn

Details for d1dkha_

PDB Entry: 1dkh (more details), 3.2 Å

PDB Description: crystal structure of the hemophore hasa, ph 6.5
PDB Compounds: (A:) heme-binding protein a

SCOPe Domain Sequences for d1dkha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkha_ d.35.1.1 (A:) Heme-binding protein A (HasA) {Serratia marcescens [TaxId: 615]}
fsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaisstan
qvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnlss
lqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata

SCOPe Domain Coordinates for d1dkha_:

Click to download the PDB-style file with coordinates for d1dkha_.
(The format of our PDB-style files is described here.)

Timeline for d1dkha_: