Lineage for d1djsb_ (1djs B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543031Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1543032Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1543033Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 1543047Species Human (Homo sapiens) [TaxId:9606] [50359] (84 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 1543212Domain d1djsb_: 1djs B: [25518]
    Other proteins in same PDB: d1djsa1, d1djsa2
    complexed with so4

Details for d1djsb_

PDB Entry: 1djs (more details), 2.4 Å

PDB Description: ligand-binding portion of fibroblast growth factor receptor 2 in complex with fgf1
PDB Compounds: (B:) protein (fibroblast growth factor 1)

SCOPe Domain Sequences for d1djsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djsb_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
gnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyl
amdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthy
gqkailflplpvssd

SCOPe Domain Coordinates for d1djsb_:

Click to download the PDB-style file with coordinates for d1djsb_.
(The format of our PDB-style files is described here.)

Timeline for d1djsb_: