Lineage for d1dj0a_ (1dj0 A:)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
consists of two alpha+beta subdomains with some similarity to the ferredoxin-like foldSuperfamily d.265.1: Pseudouridine synthase [55120] (4 families) 
the active site is the most conserved structural region of the superfamily and is located between the subdomainsFamily d.265.1.1: Pseudouridine synthase I TruA [55121] (1 protein) Protein Pseudouridine synthase I TruA [55122] (1 species) Species Escherichia coli [TaxId:562] [55123] (4 PDB entries) 
Domain d1dj0a_: 1dj0 A: [90337]
Details for d1dj0a_
PDB Entry: 1dj0 (more details), 1.5 Å
PDB Description: the crystal structure of e. coli pseudouridine synthase i at 1.5 angstrom resolution
PDB Compounds: (A:) pseudouridine synthase ISCOP Domain Sequences for d1dj0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dj0a_ d.265.1.1 (A:) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]}
ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
lvavdypdrydlpkppmgplflad
SCOP Domain Coordinates for d1dj0a_:
Click to download the PDB-style file with coordinates for d1dj0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dj0a_:
- d1dj0a_ first appeared in SCOP 1.67
- d1dj0a_ appears in SCOP 1.71
- d1dj0a_ appears in SCOP 1.75
- d1dj0a_ appears in the current release, SCOPe 2.08
View in 3D
