Lineage for d1dj0a_ (1dj0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009172Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 3009173Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 3009174Family d.265.1.1: Pseudouridine synthase I TruA [55121] (1 protein)
  6. 3009175Protein Pseudouridine synthase I TruA [55122] (1 species)
  7. 3009176Species Escherichia coli [TaxId:562] [55123] (4 PDB entries)
  8. 3009177Domain d1dj0a_: 1dj0 A: [90337]
    complexed with cl

Details for d1dj0a_

PDB Entry: 1dj0 (more details), 1.5 Å

PDB Description: the crystal structure of e. coli pseudouridine synthase i at 1.5 angstrom resolution
PDB Compounds: (A:) pseudouridine synthase I

SCOPe Domain Sequences for d1dj0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dj0a_ d.265.1.1 (A:) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]}
ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
lvavdypdrydlpkppmgplflad

SCOPe Domain Coordinates for d1dj0a_:

Click to download the PDB-style file with coordinates for d1dj0a_.
(The format of our PDB-style files is described here.)

Timeline for d1dj0a_: