Lineage for d1di2a_ (1di2 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.50: dsRBD-like [54767] (5 superfamilies)
alpha-beta(3)-alpha; 2 layers: alpha/beta
Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) 
Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
Pfam PF00035Protein Double-stranded RNA-binding protein A, second dsRBD [54770] (1 species) Species African clawed frog (Xenopus laevis) [TaxId:8355] [54771] (1 PDB entry) 
Domain d1di2a_: 1di2 A: [38780]
complexed with dsRNA
protein/RNA complex
Details for d1di2a_
PDB Entry: 1di2 (more details), 1.9 Å
PDB Description: crystal structure of a dsrna-binding domain complexed with dsrna: molecular basis of double-stranded rna-protein interactions
PDB Compounds: (A:) double stranded RNA binding protein aSCOPe Domain Sequences for d1di2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {African clawed frog (Xenopus laevis) [TaxId: 8355]}
mpvgslqelavqkgwrlpeytvaqesgpphkreftitcrvetfvetgsgtskqvakrvaa
eklltkfkt
SCOPe Domain Coordinates for d1di2a_:
Click to download the PDB-style file with coordinates for d1di2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1di2a_:
- d1di2a_ first appeared (with stable ids) in SCOP 1.55
- d1di2a_ appears in SCOPe 2.07
View in 3D
