Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (1 family) |
Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
Protein Lumazine synthase [52123] (7 species) |
Species Brucella abortus [TaxId:235] [52125] (1 PDB entry) |
Domain d1di0a_: 1di0 A: [30957] complexed with po4 |
PDB Entry: 1di0 (more details), 2.7 Å
SCOPe Domain Sequences for d1di0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1di0a_ c.16.1.1 (A:) Lumazine synthase {Brucella abortus [TaxId: 235]} tsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartg ryaaivgaafvidggiydhdfvatavingmmqvqletevpvlsvvltphhfheskehhdf fhahfkvkgveaahaalqivsersriaa
Timeline for d1di0a_:
View in 3D Domains from other chains: (mouse over for more information) d1di0b_, d1di0c_, d1di0d_, d1di0e_ |