Lineage for d1dhpa_ (1dhp A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.10: Aldolase [51569] (9 families) 
Common fold covers whole protein structureFamily c.1.10.1: Class I aldolase [51570] (13 proteins)
the catalytic lysine forms schiff-base intermediate with substrate
possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
Protein Dihydrodipicolinate synthase [51574] (12 species) 
Species Escherichia coli [TaxId:562] [51575] (15 PDB entries) 
Domain d1dhpa_: 1dhp A: [29097]
complexed with k
Details for d1dhpa_
PDB Entry: 1dhp (more details), 2.3 Å
PDB Description: dihydrodipicolinate synthase
PDB Compounds: (A:) Dihydrodipicolinate synthaseSCOPe Domain Sequences for d1dhpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dhpa_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll
SCOPe Domain Coordinates for d1dhpa_:
Click to download the PDB-style file with coordinates for d1dhpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dhpa_:
- d1dhpa_ first appeared (with stable ids) in SCOP 1.55
- d1dhpa_ appears in SCOPe 2.04
- d1dhpa_ appears in SCOPe 2.06
- d1dhpa_ appears in the current release, SCOPe 2.08
View in 3D
