Lineage for d1dgua_ (1dgu A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489858Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1489880Protein Calcium- and integrin-binding protein, CIB [47541] (1 species)
  7. 1489881Species Human (Homo sapiens) [TaxId:9606] [47542] (3 PDB entries)
    Uniprot Q99828
  8. 1489884Domain d1dgua_: 1dgu A: [17333]

Details for d1dgua_

PDB Entry: 1dgu (more details)

PDB Description: homology-based model of calcium-saturated cib (calcium-and integrin- binding protein)
PDB Compounds: (A:) calcium-saturated cib

SCOPe Domain Sequences for d1dgua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgua_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}
skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp
fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl
srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk
ivl

SCOPe Domain Coordinates for d1dgua_:

Click to download the PDB-style file with coordinates for d1dgua_.
(The format of our PDB-style files is described here.)

Timeline for d1dgua_: