Lineage for d1dgua_ (1dgu A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 640871Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 640891Protein Calcium- and integrin-binding protein, CIB [47541] (1 species)
  7. 640892Species Human (Homo sapiens) [TaxId:9606] [47542] (4 PDB entries)
  8. 640897Domain d1dgua_: 1dgu A: [17333]

Details for d1dgua_

PDB Entry: 1dgu (more details)

PDB Description: homology-based model of calcium-saturated cib (calcium-and integrin- binding protein)
PDB Compounds: (A:) calcium-saturated cib

SCOP Domain Sequences for d1dgua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgua_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}
skellaeyqdltfltkqeillahrrfcellpqeqrsvesslraqvpfeqilslpelkanp
fkericrvfstspakdslsfedfldllsvfsdtatpdikshyafrifdfdddgtlnredl
srlvncltgegedtrlsasemkqlidnileesdidrdgtinlsefqhvisrspdfassfk
ivl

SCOP Domain Coordinates for d1dgua_:

Click to download the PDB-style file with coordinates for d1dgua_.
(The format of our PDB-style files is described here.)

Timeline for d1dgua_: