Class a: All alpha proteins [46456] (290 folds) |
Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) contains 2Fe-2S cluster |
Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins) |
Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species) |
Species Desulfovibrio desulfuricans [TaxId:876] [47745] (1 PDB entry) |
Domain d1dgja1: 1dgj A:81-193 [17909] Other proteins in same PDB: d1dgja2, d1dgja3, d1dgja4 complexed with 2mo, fes, mcn |
PDB Entry: 1dgj (more details), 2.8 Å
SCOPe Domain Sequences for d1dgja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dgja1 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio desulfuricans [TaxId: 876]} apdclhplqhawiqhgaaqcgfctpgfivsakalldenvapsredvrdwfqkhhnicrct gykplvdavmdaaailrgektveeisfkmpadgriwgssiprpsavakvtgla
Timeline for d1dgja1: