Lineage for d1dfea_ (1dfe A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1066861Fold g.42: Ribosomal protein L36 [57839] (1 superfamily)
    zinc-bound beta-ribbon motif
  4. 1066862Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family) (S)
  5. 1066863Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein)
  6. 1066864Protein Ribosomal protein L36 [57842] (3 species)
  7. 1066904Species Thermus thermophilus [TaxId:274] [57843] (6 PDB entries)
  8. 1066905Domain d1dfea_: 1dfe A: [45318]
    complexed with zn

Details for d1dfea_

PDB Entry: 1dfe (more details)

PDB Description: nmr structure of ribosomal protein l36 from thermus thermophilus
PDB Compounds: (A:) l36 ribosomal protein

SCOPe Domain Sequences for d1dfea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfea_ g.42.1.1 (A:) Ribosomal protein L36 {Thermus thermophilus [TaxId: 274]}
mkvrasvkricdkckvirrhgrvyvicenpkhkqrqg

SCOPe Domain Coordinates for d1dfea_:

Click to download the PDB-style file with coordinates for d1dfea_.
(The format of our PDB-style files is described here.)

Timeline for d1dfea_: