Lineage for d1dewb_ (1dew B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988140Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2988163Protein DNA repair endonuclease Hap1 [56223] (1 species)
    Major apurinic/apyrimidinic endonuclease APE1
  7. 2988164Species Human (Homo sapiens) [TaxId:9606] [56224] (15 PDB entries)
  8. 2988180Domain d1dewb_: 1dew B: [41787]
    protein/DNA complex; complexed with so4

Details for d1dewb_

PDB Entry: 1dew (more details), 2.65 Å

PDB Description: crystal structure of human ape1 bound to abasic dna
PDB Compounds: (B:) major apurinic/apyrimidinic endonuclease

SCOPe Domain Sequences for d1dewb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dewb_ d.151.1.1 (B:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
egpalyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkc
senklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrviv
aefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeid
lrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvg
wrldyfllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d1dewb_:

Click to download the PDB-style file with coordinates for d1dewb_.
(The format of our PDB-style files is described here.)

Timeline for d1dewb_: