Lineage for d1ddxa2 (1ddx A:33-73)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031550Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 3031551Species Mouse (Mus musculus) [TaxId:10090] [57212] (13 PDB entries)
  8. 3031590Domain d1ddxa2: 1ddx A:33-73 [44275]
    Other proteins in same PDB: d1ddxa1, d1ddxb1, d1ddxc1, d1ddxd1
    complexed with bog, nag, pgx

Details for d1ddxa2

PDB Entry: 1ddx (more details), 3 Å

PDB Description: crystal structure of a mixture of arachidonic acid and prostaglandin bound to the cyclooxygenase active site of cox-2: prostaglandin structure
PDB Compounds: (A:) protein (prostaglandin h2 synthase-2)

SCOPe Domain Sequences for d1ddxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddxa2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOPe Domain Coordinates for d1ddxa2:

Click to download the PDB-style file with coordinates for d1ddxa2.
(The format of our PDB-style files is described here.)

Timeline for d1ddxa2: