Lineage for d1ddfa_ (1ddf A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 918821Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 918822Superfamily a.77.1: DEATH domain [47986] (4 families) (S)
  5. 918823Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 918831Protein Fas [47990] (1 species)
  7. 918832Species Human (Homo sapiens) [TaxId:9606] [47991] (1 PDB entry)
  8. 918833Domain d1ddfa_: 1ddf A: [18423]

Details for d1ddfa_

PDB Entry: 1ddf (more details)

PDB Description: fas death domain, nmr, minimized average structure
PDB Compounds: (A:) fas

SCOPe Domain Sequences for d1ddfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddfa_ a.77.1.2 (A:) Fas {Human (Homo sapiens) [TaxId: 9606]}
metvainlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvq
llrnwhqlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvl
ehhhhhh

SCOPe Domain Coordinates for d1ddfa_:

Click to download the PDB-style file with coordinates for d1ddfa_.
(The format of our PDB-style files is described here.)

Timeline for d1ddfa_: