Lineage for d1dd3a1 (1dd3 A:1-57)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775032Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
    multihelical; intertwined tetramer
  4. 775033Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) (S)
  5. 775034Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)
  6. 775035Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)
  7. 775047Species Thermotoga maritima [TaxId:2336] [48303] (6 PDB entries)
  8. 775060Domain d1dd3a1: 1dd3 A:1-57 [19031]
    Other proteins in same PDB: d1dd3a2, d1dd3b2

Details for d1dd3a1

PDB Entry: 1dd3 (more details), 2 Å

PDB Description: crystal structure of ribosomal protein l12 from thermotoga maritima
PDB Compounds: (A:) 50S ribosomal protein L7/L12

SCOP Domain Sequences for d1dd3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd3a1 a.108.1.1 (A:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]}
mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeekt

SCOP Domain Coordinates for d1dd3a1:

Click to download the PDB-style file with coordinates for d1dd3a1.
(The format of our PDB-style files is described here.)

Timeline for d1dd3a1: